Today Only: Up to 50% Off at https://kidcar.com · New Arrivals Added Daily · Fast & Secure Checkout
Top Pick at kidcar.com

Recombinant Probable ubiquinone biosynthesis protein UbiB(ubiB)

$2,130.80
$3,771.52
Save 44%

Price includes all applicable taxes. Free shipping on orders over $50.

Title
Ready to ship
Usually dispatches within 2 business days
In stock

Secure checkout powered by https://kidcar.com

Quality guaranteeEvery item inspected before listing
Easy returns30-day return policy on all orders
Free deliveryOn orders over $50 at https://kidcar.com

Free standard shipping on orders over $50 at https://kidcar.com. Express delivery options available at checkout. Most orders ship within 1-2 business days.

We offer a 30-day return policy on all purchases. If you are not satisfied, simply contact our support team for a full refund or exchange.

Kidcar is your trusted online store at kidcar.com. We carefully select every product to ensure quality, authenticity, and value. Shop with confidence knowing each item is backed by our satisfaction guarantee. Free shipping over $50 and 30-day returns included.
Quality picks
Hand-selected by our team
New daily
Fresh arrivals every morning
Secure checkout
Your data is always protected
24/7 support
We are here to help anytime
Product details
Recombinant  Probable ubiquinone biosynthesis protein UbiB(ubiB) View 1

Recombinant Probable ubiquinone biosynthesis protein Ubi...

Size:50 ug. Other sizes are also available. Please Inquire. Product Type:Recombinant ProteinSpecies:Azotobacter chroococcum mcd 1Uniprot NO.:Q43924Tag Info:The tag type will be determined during production process.Storage Buffer:Tris-based buffer,50% glycerol, optimized for this proteinStorage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.AA Sequence:EFEAAIRTVCEPIFEKPLKDISFGQLLLRLFQTARRFNMEVQPQLVLLQKTLLNIEGLGR QLYPELDLWTTAKPFLERWMRKRMSPKAMLDNLQGQLEQLPHLAQMTRAALEGMARPAHG APPPRDRHILRLLGAALLAGGVLLASRAPLNVADAWPGWLMLASGLYLLVRRQRFPDProtein Names:Recommended name: Probable ubiquinone biosynthesis protein UbiBGene Names:Name:ubiBExpression Region:1-177Sequence Info:full length protein
FAQ
Why shop at kidcar.com?

kidcar.com hand-picks every product for quality and value. We offer unbeatable daily discounts, free shipping over $50, and 30-day easy returns — all backed by our dedicated support team.

How do I get the 50% off deal?

Our daily flash sale gives up to 50% off selected items. The discount is already reflected in the price you see on this page. No coupon code needed — just add to cart and check out at kidcar.com.

Is my payment secure?

Absolutely. All transactions at kidcar.com are processed through encrypted, industry-standard checkout. Your payment details are never stored on our servers.

How fast is shipping?

Most orders ship within 1-2 business days. Standard delivery is free on orders over $50 at kidcar.com. Express shipping options are also available at checkout.

What if I need to return something?

We offer a hassle-free 30-day return policy. Simply contact support@kidcar.com and our team at kidcar.com will walk you through the process and issue your refund promptly.

Brand
Gene Bio Systems
More from Kidcar

Gene Bio Systems Recombinant Probable ubiquinone

Exclusive deals

Up to 50% off every day at Kidcar.

Sign up for early access to sales, new arrivals, and special offers available only at https://kidcar.com. Custom 4 Piece Bathroom Set Keurig Coffee Keurig K-Duo Essentials Hot & Iced Coffee Maker

Current price
$2,130.80